PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_7BL_625F55A12.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bZIP
Protein Properties Length: 145aa    MW: 16429.7 Da    PI: 10.6102
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_7BL_625F55A12.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_130.57.9e-101461156
                           HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                 bZIP_1 11 qkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56
                           ++NR +A +sR+RKk +++ Le+k+k Leae ++L   l+    e 
  Traes_7BL_625F55A12.1  1 MRNRDSAMKSRERKKSYVKDLETKSKYLEAECRRLSYALQCCAAEN 46
                           7*******************************99997777665555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF001707.1E-8152IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.25E-9153No hitNo description
CDDcd147043.57E-10147No hitNo description
Gene3DG3DSA:1.20.5.1702.8E-11154No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0030968Biological Processendoplasmic reticulum unfolded protein response
GO:0005634Cellular Componentnucleus
GO:0005789Cellular Componentendoplasmic reticulum membrane
GO:0016021Cellular Componentintegral component of membrane
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 145 aa     Download sequence    Send to blast
MRNRDSAMKS RERKKSYVKD LETKSKYLEA ECRRLSYALQ CCAAENMALR QNMLKDRPIG  60
AHTAMQESAV LSXXLPLVSL LWLVSIVCLF LTPGLPNRSL AAPRRAERGL AMVAGKPSSD  120
QPETLELLPH GRRWRGTRER IKLDA
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3655050.0AK365505.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2034K24.
GenBankAK3685650.0AK368565.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv2076C04.
GenBankAK3699570.0AK369957.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2101P04.
GenBankAK3701490.0AK370149.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2105L10.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004965858.12e-75PREDICTED: bZIP transcription factor 60-like
TrEMBLW5HMP61e-100W5HMP6_WHEAT; Uncharacterized protein
STRINGMLOC_22013.18e-93(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP69343750
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G42990.15e-12basic region/leucine zipper motif 60
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]